ANGPTL7 Antibody - #DF3778
Product: | ANGPTL7 Antibody |
Catalog: | DF3778 |
Description: | Rabbit polyclonal antibody to ANGPTL7 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 50 KD; 40kD(Calculated). |
Uniprot: | O43827 |
RRID: | AB_2835903 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3778, RRID:AB_2835903.
Fold/Unfold
Angiopoietin like 7; Angiopoietin like factor (CDT6); Angiopoietin like factor; Angiopoietin related protein 7; Angiopoietin-like factor; Angiopoietin-like protein 7; Angiopoietin-related protein 7; ANGL7_HUMAN; ANGPTL7; AngX; CDT6; Cornea derived transcript 6 protein; Cornea-derived transcript 6 protein; dJ647M16.1; OTTHUMP00000001986; RP4-647M16.2;
Immunogens
A synthesized peptide derived from human ANGPTL7, corresponding to a region within C-terminal amino acids.
Higly expressed in the cornea (at protein level) (PubMed:11682471). Expression is restricted to the stromal layer (PubMed:11682471). Also detected at the junction between the corneal stromal layer and the conjuctiva. Not detected in the sclera (PubMed:11682471).
- O43827 ANGL7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure. Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency.
Secreted.
Higly expressed in the cornea (at protein level). Expression is restricted to the stromal layer. Also detected at the junction between the corneal stromal layer and the conjuctiva. Not detected in the sclera.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.