TSPAN8 Antibody - #AF0362
| Product: | TSPAN8 Antibody |
| Catalog: | AF0362 |
| Description: | Rabbit polyclonal antibody to TSPAN8 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 26kDa; 26kD(Calculated). |
| Uniprot: | P19075 |
| RRID: | AB_2833527 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0362, RRID:AB_2833527.
Fold/Unfold
anti TSPAN8; CO029; Tetraspanin 8; Tetraspanin-8; TM4SF3; Transmembrane 4 superfamily member 3; TSN8_HUMAN; Tspan 8; Tspan-8; TSPAN8; TSPAN8 antibody; Tumor associated antigen CO 029; Tumor-associated antigen CO-029;
Immunogens
A synthesized peptide derived from human TSPAN8, corresponding to a region within the internal amino acids.
- P19075 TSN8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Research Backgrounds
Membrane>Multi-pass membrane protein.
Gastric, colon, rectal, and pancreatic carcinomas.
Belongs to the tetraspanin (TM4SF) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.