Cytochrome P450 3A43 Antibody - #DF3584
| Product: | Cytochrome P450 3A43 Antibody |
| Catalog: | DF3584 |
| Description: | Rabbit polyclonal antibody to Cytochrome P450 3A43 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 57 KD; 58kD(Calculated). |
| Uniprot: | Q9HB55 |
| RRID: | AB_2835956 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3584, RRID:AB_2835956.
Fold/Unfold
Cytochrome P450 family 3 subfamily A polypeptide 43; Cytochrome P450 polypeptide 43; Cytochrome P450 subfamily IIIA polypeptide 43; MGC119315; MGC119316;
Immunogens
A synthesized peptide derived from human Cytochrome P450 3A43, corresponding to a region within the internal amino acids.
Highest expression level in prostate. Also expressed in liver, kidney, pancreas, fetal liver and fetal skeletal muscle.
- Q9HB55 CP343_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP
Research Backgrounds
Exhibits low testosterone 6-beta-hydroxylase activity.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Highest expression level in prostate. Also expressed in liver, kidney, pancreas, fetal liver and fetal skeletal muscle.
Belongs to the cytochrome P450 family.
Research Fields
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.