Cytochrome P450 4X1 Antibody - #DF3589
Product: | Cytochrome P450 4X1 Antibody |
Catalog: | DF3589 |
Description: | Rabbit polyclonal antibody to Cytochrome P450 4X1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Dog |
Mol.Wt.: | 50 KD; 59kD(Calculated). |
Uniprot: | Q8N118 |
RRID: | AB_2835961 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3589, RRID:AB_2835961.
Fold/Unfold
CYPIVX1; Cytochrome P450 4X1; Cytochrome P450, family 4, subfamily X, polypeptide 1;
Immunogens
Expressed in brain, heart, kidney and skin and, at lower levels, in skeletal muscle and liver (PubMed:16478468, PubMed:18549450). In the brain, high levels are detected in amygdala and lower levels in globus pallidus and cerebellum (PubMed:18549450). In the heart, very high levels in aorta, but very low levels in other heart regions (PubMed:16478468, PubMed:18549450). Also expressed in breast, prostate and colon (PubMed:18549450).
- Q8N118 CP4X1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSEC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N118 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K75 | Ubiquitination | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K132 | Ubiquitination | Uniprot | |
S268 | Phosphorylation | Uniprot | |
K274 | Ubiquitination | Uniprot | |
S292 | Phosphorylation | Uniprot |
Research Backgrounds
A cytochrome P450 monooxygenase that selectively catalyzes the epoxidation of the last double bond of the arachidonoyl moiety of anandamide, potentially modulating endocannabinoid signaling. Has no hydroxylase activity toward various fatty acids, steroids and prostaglandins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Endoplasmic reticulum membrane>Single-pass membrane protein. Microsome membrane>Single-pass membrane protein.
Expressed in brain, heart, kidney and skin and, at lower levels, in skeletal muscle and liver. In the brain, high levels are detected in amygdala and lower levels in globus pallidus and cerebellum. In the heart, very high levels in aorta, but very low levels in other heart regions. Also expressed in breast, prostate and colon.
Belongs to the cytochrome P450 family.
Research Fields
· Organismal Systems > Nervous system > Serotonergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.