BCL2L2 Antibody - #DF3607
| Product: | BCL2L2 Antibody |
| Catalog: | DF3607 |
| Description: | Rabbit polyclonal antibody to BCL2L2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 25 KD; 21kD(Calculated). |
| Uniprot: | Q92843 |
| RRID: | AB_2835979 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3607, RRID:AB_2835979.
Fold/Unfold
Apoptosis regulator BCL W; Apoptosis regulator Bcl-W; B2CL2_HUMAN; BCL 2 Like 2; Bcl 2 like 2 protein; Bcl 2L2; BCL W; Bcl-2-like protein 2; Bcl2 L2; BCL2 like 2; BCL2 like 2 protein; Bcl2-L-2; Bcl2l2; BCLW; KIAA0271; PPP1R51; Protein phosphatase 1 regulatory subunit 51;
Immunogens
A synthesized peptide derived from human BCL2L2, corresponding to a region within N-terminal amino acids.
Expressed (at protein level) in a wide range of tissues with highest levels in brain, spinal cord, testis, pancreas, heart, spleen and mammary glands. Moderate levels found in thymus, ovary and small intestine. Not detected in salivary gland, muscle or liver. Also expressed in cell lines of myeloid, fibroblast and epithelial origin. Not detected in most lymphoid cell lines.
- Q92843 B2CL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.
Mitochondrion membrane>Peripheral membrane protein.
Note: Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane.
Expressed (at protein level) in a wide range of tissues with highest levels in brain, spinal cord, testis, pancreas, heart, spleen and mammary glands. Moderate levels found in thymus, ovary and small intestine. Not detected in salivary gland, muscle or liver. Also expressed in cell lines of myeloid, fibroblast and epithelial origin. Not detected in most lymphoid cell lines.
The BH4 motif seems to be involved in the anti-apoptotic function.
The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3-binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2.
Belongs to the Bcl-2 family.
Research Fields
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.