CIDEB Antibody - #DF3608
Product: | CIDEB Antibody |
Catalog: | DF3608 |
Description: | Rabbit polyclonal antibody to CIDEB |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 24 KD; 25kD(Calculated). |
Uniprot: | Q9UHD4 |
RRID: | AB_2835980 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3608, RRID:AB_2835980.
Fold/Unfold
Cell death activator CIDE B; Cell death activator CIDE-B; Cell death inducing DFFA like effector B; Cell death-inducing DFFA-like effector B; CIDEB; CIDEB_HUMAN;
Immunogens
Highly expressed in liver and small intestine and, at lower levels, in colon, kidney and spleen.
- Q9UHD4 CIDEB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UHD4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S17 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot |
Research Backgrounds
Activates apoptosis.
Highly expressed in liver and small intestine and, at lower levels, in colon, kidney and spleen.
Inhibited by DFFB. Interacts with DFFA and DFFB.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.