DMC1 Antibody - #AF0378
Product: | DMC1 Antibody |
Catalog: | AF0378 |
Description: | Rabbit polyclonal antibody to DMC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 86kDa; 38kD(Calculated). |
Uniprot: | Q14565 |
RRID: | AB_2833537 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0378, RRID:AB_2833537.
Fold/Unfold
Disrupted meiotic cDNA 1 homolog; Disrupted meiotic cDNA 1, yeast, homolog of; dJ199H16.1; DMC 1; DMC1; DMC1 dosage suppressor of mck1 homolog; DMC1 dosage suppressor of mck1 homolog meiosis specific homologous recombination (yeast); DMC1 homologue; DMC1_HUMAN; DMC1H; DNA meiotic recombinase 1; HsLim15; LIM15; Meiotic recombination protein DMC1/LIM15 homolog; MGC150472; MGC150473;
Immunogens
- Q14565 DMC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
Nucleus. Chromosome.
Interacts with the MND1-PSMC3IP heterodimer (By similarity). Double stacked ring-shaped homooctamer. Interacts with BRCA2.
Belongs to the RecA family. DMC1 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.