POU4F3 Antibody - #DF3638
Product: | POU4F3 Antibody |
Catalog: | DF3638 |
Description: | Rabbit polyclonal antibody to POU4F3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 35 KD; 37kD(Calculated). |
Uniprot: | Q15319 |
RRID: | AB_2836010 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3638, RRID:AB_2836010.
Fold/Unfold
Brain specific homeobox/POU domain protein 3C; Brain-3C; Brain-specific homeobox/POU domain protein 3C; BRN 3C; Brn-3C; BRN3C; class 4; DFNA 15; DFNA15; MGC138412; PO4F3_HUMAN; POU class 4 homeobox 3; POU domain; POU domain class 4 transcription factor 3; POU4F3; transcription factor 3;
Immunogens
A synthesized peptide derived from human POU4F3, corresponding to a region within the internal amino acids.
- Q15319 PO4F3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as a transcriptional activator. Acts by binding to sequences related to the consensus octamer motif 5'-ATGCAAAT-3' in the regulatory regions of its target genes. Involved in the auditory system development, required for terminal differentiation of hair cells in the inner ear (By similarity).
Nucleus. Cytoplasm.
Note: Preferentially localized in the nucleus.
Brain. Seems to be specific to the retina.
Belongs to the POU transcription factor family. Class-4 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.