MRPS35 Antibody - #DF3650
| Product: | MRPS35 Antibody |
| Catalog: | DF3650 |
| Description: | Rabbit polyclonal antibody to MRPS35 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 40 KD; 37kD(Calculated). |
| Uniprot: | P82673 |
| RRID: | AB_2836022 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3650, RRID:AB_2836022.
Fold/Unfold
28S ribosomal protein S28; 28S ribosomal protein S28, mitochondrial; 28S ribosomal protein S35; 28S ribosomal protein S35 mitochondrial precursor; 28S ribosomal protein S35, mitochondrial; DKFZp762P093; HDCMD11P; MDS023; MGC104278; mitochondrial; Mitochondrial ribosomal protein S28; Mitochondrial ribosomal protein S35; MRP S28; MRP S35; MRP-S28; MRP-S35; MRPS 28; MRPS 35; MRPS28; MRPS35; OTTHUMP00000240420; OTTHUMP00000240422; OTTHUMP00000240424; PSEC0213; RT35_HUMAN; S28mt; S35mt;
Immunogens
A synthesized peptide derived from human MRPS35, corresponding to a region within N-terminal amino acids.
- P82673 RT35_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Research Backgrounds
Mitochondrion.
Belongs to the mitochondrion-specific ribosomal protein mS35 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.