MRPL51 Antibody - #DF3674
| Product: | MRPL51 Antibody |
| Catalog: | DF3674 |
| Description: | Rabbit polyclonal antibody to MRPL51 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 20 KD; 15kD(Calculated). |
| Uniprot: | Q4U2R6 |
| RRID: | AB_2836046 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3674, RRID:AB_2836046.
Fold/Unfold
39S ribosomal protein L51; 39S ribosomal protein L51 mitochondrial; bMRP-64; bMRP64; CDA09; HSPC241; L51mt; mitochondrial; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; mitochondrial ribosomal protein L51; MRP-L51; MRP64; mrpl51; RM51_HUMAN;
Immunogens
A synthesized peptide derived from human MRPL51, corresponding to a region within C-terminal amino acids.
- Q4U2R6 RM51_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
Research Backgrounds
Mitochondrion.
Belongs to the mitochondrion-specific ribosomal protein mL51 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.