TROVE2 Antibody - #DF3693
Product: | TROVE2 Antibody |
Catalog: | DF3693 |
Description: | Rabbit polyclonal antibody to TROVE2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Sheep, Rabbit, Chicken |
Mol.Wt.: | 70 KD; 61kD(Calculated). |
Uniprot: | P10155 |
RRID: | AB_2836057 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3693, RRID:AB_2836057.
Fold/Unfold
60 kDa ribonucleoprotein Ro; 60 kDa Ro protein; 60 kDa SS A/Ro ribonucleoprotein; 60 kDa SS-A/Ro ribonucleoprotein; Autoantigen Ro/SSA, 60-KD; bA101E13.2; Gastric cancer multi drug resistance protein; Ribonucleoprotein autoantigen SS A/Ro; RO 60; Ro 60 kDa autoantigen; RO60; RO60_HUMAN; RoRNP; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2; SS A; SS-A; SS-A/Ro; SSA 2; SSA; SSA2; TROVE 2; TROVE domain family member 2; TROVE2;
Immunogens
A synthesized peptide derived from human TROVE2, corresponding to a region within N-terminal amino acids.
- P10155 RO60_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.
May play roles in cilia formation and/or maintenance.
Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
The horseshoe-shaped TROVE domain is built with 7 helical HEAT-like repeats, and is closed by the VWFA-like domain giving rise to a ring-shaped monomer. Single-stranded RNA is bound in the positively charged central cavity (By similarity).
The MIDAS-like motif in the VWFA-like domain binds divalent metal cations.
Belongs to the Ro 60 kDa family.
Research Fields
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.