Product: AKR1C2 Antibody
Catalog: DF3757
Description: Rabbit polyclonal antibody to AKR1C2
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 37 KD(Observed); 37kD(Calculated).
Uniprot: P52895
RRID: AB_2836121

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
AKR1C2 Antibody detects endogenous levels of total AKR1C2.
RRID:
AB_2836121
Cite Format: Affinity Biosciences Cat# DF3757, RRID:AB_2836121.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2-dihydrobenzene-1; 2-diol dehydrogenase; 3 alpha HSD3; 3 alpha hydroxysteroid dehydrogenase type III; 3-alpha-HSD3; AK1C2_HUMAN; AKR1C pseudo; AKR1C2; Aldo keto reductase family 1 member C2; Aldo-keto reductase family 1 member C2; BABP; Bile acid binding protein; Chlordecone reductase homolog; Chlordecone reductase homolog HAKRD; DD; DD-2; DD/BABP; DD2; DDH 2; DDH2; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid binding protein; Dihydrodiol dehydrogenase/bile acid-binding protein; FLJ53800; HAKRD; HBAB; MCDR 2; MCDR2; OTTHUMP00000044759; Pseudo chlordecone reductase; SRXY8; Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase; Trans-1; Type II dihydrodiol dehydrogenase; Type III 3 alpha hydroxysteroid dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase;

Immunogens

Immunogen:

A synthesized peptide derived from human AKR1C2, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P52895 AK1C2_HUMAN:

Expressed in fetal testes. Expressed in fetal and adult adrenal glands.

Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Research Backgrounds

Function:

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in fetal testes. Expressed in fetal and adult adrenal glands.

Family&Domains:

Belongs to the aldo/keto reductase family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

References

1). AKR1C2 silencing promotes ferroptosis and inhibits proliferation, migration, and invasion in lung cancer cells. PloS one, 2025 (PubMed: 40531841) [IF=2.9]

Application: WB    Species: human    Sample: A549 cells

Fig 5. Transfection of A549 cells with siRNA. (A) The knockdown efficiency of AKR1C2 mRNA expression level was detected by qRT-PCR (n = 4). (B) The knockdown effect of AKR1C2 protein levels was detected by Western blot (n = 8). ***P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.