NECAB3 Antibody - #DF3770
Product: | NECAB3 Antibody |
Catalog: | DF3770 |
Description: | Rabbit polyclonal antibody to NECAB3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 44 KD; 44kD(Calculated). |
Uniprot: | Q96P71 |
RRID: | AB_2836134 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3770, RRID:AB_2836134.
Fold/Unfold
amyloid beta (A4) precursor protein binding, family A, member 2 binding protein; Amyloid beta A4 protein binding family A member 2 binding protein; Amyloid beta A4 protein-binding family A member 2-binding protein; APBA2BP; dJ63M2.4; dJ63M2.5; EFCBP3; N terminal EF hand calcium binding protein 3; N-terminal EF-hand calcium-binding protein 3; NECA3_HUMAN; NECAB3; Nek2 interacting protein 1; Nek2-interacting protein 1; Neuronal calcium binding protein 3; Neuronal calcium-binding protein 3; NIP1; STIP3; Synaptotagmin interacting protein 2; SYTIP2; X11L binding protein 51; X11L-binding protein 51; XB51;
Immunogens
A synthesized peptide derived from human NECAB3, corresponding to a region within the internal amino acids.
Strongly expressed in heart and skeletal muscle, moderately in brain and pancreas.
- Q96P71 NECA3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta. May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3.
Phosphorylated by NEK2.
Golgi apparatus.
Strongly expressed in heart and skeletal muscle, moderately in brain and pancreas.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.