ATP5S Antibody - #DF3808
Product: | ATP5S Antibody |
Catalog: | DF3808 |
Description: | Rabbit polyclonal antibody to ATP5S |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 23 KD; 25kD(Calculated). |
Uniprot: | Q99766 |
RRID: | AB_2836165 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3808, RRID:AB_2836165.
Fold/Unfold
ATP synthase coupling factor B like 1; ATP synthase coupling factor B mitochondrial; ATP synthase H+ transporting mitochondrial Fo complex subunit s (factor B); ATP synthase subunit s; ATP synthase subunit s mitochondrial; ATP synthase-coupling factor B; Atp5s; ATP5S_HUMAN; ATPW; FB; HSU79253; mitochondrial; Mitochondrial ATP synthase regulatory component factor B;
Immunogens
A synthesized peptide derived from human ATP5S, corresponding to a region within the internal amino acids.
- Q99766 ATP5S_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.
Mitochondrion. Mitochondrion inner membrane.
Belongs to the ATP synthase subunit s family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.