DDX19B Antibody - #DF3817
Product: | DDX19B Antibody |
Catalog: | DF3817 |
Description: | Rabbit polyclonal antibody to DDX19B |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Chicken |
Mol.Wt.: | 50 KD; 54kD(Calculated). |
Uniprot: | Q9UMR2 |
RRID: | AB_2836174 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3817, RRID:AB_2836174.
Fold/Unfold
ATP-dependent RNA helicase DDX19B; DBP5; Dbp5, yeast, homolog of; DD19B_HUMAN; DDX19; DDX19B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B; DEAD box protein 19B; DEAD box RNA helicase DEAD5; DEAD-box protein 5; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); DEAD/H BOX 19; helicase DEAD5; RNAh; TDBP; yeast Dbp5 homolog;
Immunogens
A synthesized peptide derived from human DDX19B, corresponding to a region within N-terminal amino acids.
- Q9UMR2 DD19B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.
Cytoplasm. Nucleus>Nuclear pore complex. Nucleus membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Nuclear pore complex cytoplasmic fibrils.
The N-terminal extension helix acts as an autoinhibitory domain, preventing ATP hydrolysis, unless the N-terminus of the protein is displaced by RNA binding, allowing cleft closure to bring key side chains into position for catalysis.
Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.