BNIP2 Antibody - #DF3827
| Product: | BNIP2 Antibody |
| Catalog: | DF3827 |
| Description: | Rabbit polyclonal antibody to BNIP2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 40-50kD; 36kD(Calculated). |
| Uniprot: | Q12982 |
| RRID: | AB_2836184 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3827, RRID:AB_2836184.
Fold/Unfold
BCL2/adenovirus E1B 19 kDa protein interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BCL2/adenovirus E1B 19kDa interacting protein 2; BNIP 2; Bnip2; BNIP2_HUMAN; NIP2;
Immunogens
- Q12982 BNIP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q12982 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K7 | Sumoylation | Uniprot | |
| S41 | Phosphorylation | Uniprot | |
| S77 | Phosphorylation | Uniprot | |
| T87 | Phosphorylation | Uniprot | |
| S89 | Phosphorylation | Uniprot | |
| S92 | Phosphorylation | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| S114 | Phosphorylation | Uniprot | |
| T116 | Phosphorylation | Uniprot | |
| Y118 | Phosphorylation | Uniprot | |
| T119 | Phosphorylation | Uniprot | |
| K124 | Ubiquitination | Uniprot | |
| K145 | Ubiquitination | Uniprot | |
| Y185 | Phosphorylation | Uniprot | |
| K219 | Ubiquitination | Uniprot | |
| K228 | Ubiquitination | Uniprot | |
| Y230 | Phosphorylation | Uniprot | |
| K267 | Ubiquitination | Uniprot | |
| K306 | Ubiquitination | Uniprot |
Research Backgrounds
Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins.
Cytoplasm. Cytoplasm>Perinuclear region.
Note: Localizes to the nuclear envelope region and to other cytoplasmic structures.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.