PNPLA8 Antibody - #DF3865
| Product: | PNPLA8 Antibody |
| Catalog: | DF3865 |
| Description: | Rabbit polyclonal antibody to PNPLA8 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 88 KD; 88kD(Calculated). |
| Uniprot: | Q9NP80 |
| RRID: | AB_2836222 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3865, RRID:AB_2836222.
Fold/Unfold
Calcium-independent phospholipase A2-gamma; Intracellular membrane associated calcium independent phospholipase A2 gamma; Intracellular membrane-associated calcium-independent phospholipase A2 gamma; IPLA2 2; iPLA2 gamma; IPLA2(GAMMA); iPLA2-2; iPLA2-gamma; IPLA22; IPLA2G; Patatin like phospholipase domain containing protein 8; Patatin-like phospholipase domain-containing protein 8; PLPL8_HUMAN; PNPLA-gamma; PNPLA8;
Immunogens
Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart.
- Q9NP80 PLPL8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFSKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NP80 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S89 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| R125 | Methylation | Uniprot | |
| Y192 | Phosphorylation | Uniprot | |
| K233 | Ubiquitination | Uniprot | |
| K239 | Ubiquitination | Uniprot | |
| K245 | Ubiquitination | Uniprot | |
| S347 | Phosphorylation | Uniprot | |
| S358 | Phosphorylation | Uniprot | |
| T381 | Phosphorylation | Uniprot | |
| K438 | Ubiquitination | Uniprot | |
| S511 | Phosphorylation | Q9BUB5 (MKNK1) | Uniprot |
| S515 | Phosphorylation | Uniprot | |
| K561 | Ubiquitination | Uniprot | |
| Y663 | Phosphorylation | Uniprot | |
| T670 | Phosphorylation | Uniprot | |
| K726 | Ubiquitination | Uniprot | |
| K736 | Ubiquitination | Uniprot | |
| K756 | Ubiquitination | Uniprot | |
| K767 | Ubiquitination | Uniprot |
Research Backgrounds
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids.
Endoplasmic reticulum membrane>Single-pass membrane protein. Golgi apparatus membrane>Single-pass membrane protein. Cytoplasm>Perinuclear region.
Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.