BORG3 Antibody - #DF3911
| Product: | BORG3 Antibody |
| Catalog: | DF3911 |
| Description: | Rabbit polyclonal antibody to BORG3 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Dog |
| Mol.Wt.: | 22 KD; 15kD(Calculated). |
| Uniprot: | Q6NZY7 |
| RRID: | AB_2836264 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3911, RRID:AB_2836264.
Fold/Unfold
Binder of Rho GTPase 3 like; Binder of Rho GTPases 3; BORG3; CDC42 effector protein (Rho GTPase binding) 5; CDC42 effector protein 5; CEP5;
Immunogens
- Q6NZY7 BORG3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADLELNDVIGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6NZY7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Phosphorylation | Uniprot | ||
| S22 | Phosphorylation | Uniprot | |
| S24 | Phosphorylation | Uniprot | |
| R38 | Methylation | Uniprot |
Research Backgrounds
Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts. Inhibits MAPK8 independently of CDC42 binding. Controls septin organization and this effect is negatively regulated by CDC42 (By similarity).
Endomembrane system>Peripheral membrane protein. Cytoplasm>Cytoskeleton.
Interacts with CDC42, in a GTP-dependent manner, and with SEPT7.
The CRIB domain mediates interaction with CDC42.
Belongs to the BORG/CEP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.