COPZ1 Antibody - #DF3952
| Product: | COPZ1 Antibody |
| Catalog: | DF3952 |
| Description: | Rabbit polyclonal antibody to COPZ1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 20 KD; 20kD(Calculated). |
| Uniprot: | P61923 |
| RRID: | AB_2836305 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3952, RRID:AB_2836305.
Fold/Unfold
5930435A22Rik; AA407760; CGI 120; Coatomer protein complex subunit zeta 1; Coatomer subunit zeta 1; Coatomer subunit zeta-1; COPZ; COPZ 1; COPZ1; COPZ1_HUMAN; D4Ertd360e; HSPC181; MGC118060; Zeta 1 coat protein; zeta 1 COP; zeta COP; Zeta-1 COP; Zeta-1-coat protein; Zeta1 COP;
Immunogens
A synthesized peptide derived from human COPZ1, corresponding to a region within N-terminal amino acids.
- P61923 COPZ1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity). The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex (By similarity).
Cytoplasm. Golgi apparatus membrane>Peripheral membrane protein>Cytoplasmic side. Cytoplasmic vesicle>COPI-coated vesicle membrane>Peripheral membrane protein>Cytoplasmic side.
Note: The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
Belongs to the adaptor complexes small subunit family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.