CD55 Antibody - #DF3965
| Product: | CD55 Antibody |
| Catalog: | DF3965 |
| Description: | Rabbit polyclonal antibody to CD55 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Dog |
| Mol.Wt.: | 41 KD; 41kD(Calculated). |
| Uniprot: | P08174 |
| RRID: | AB_2836318 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3965, RRID:AB_2836318.
Fold/Unfold
CD 55; CD55; CD55 antigen; CD55 Cromer blood group system; CD55 molecule (Cromer blood group); CD55 molecule; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay accelerating factor; Complement decay-accelerating factor; Complement decay-accelerating factor, GPI-anchored; CR; CROM; Cromer Blood Group antigen; Cromer blood group system; DAF; Daf-GPI; DAF_HUMAN; Daf1; Dcay accelerating factor for complement (CD55, Cromer blood group system); Decay accelarating factor 1, isoform CRA_a; Decay accelerating factor (GPI-form); Decay Accelerating Factor for Complement; Decay accelerating factor GPI-form; Decay accelerating factor soluble-form; GPI-DAF; TC;
Immunogens
A synthesized peptide derived from human CD55, corresponding to a region within the internal amino acids.
Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
- P08174 DAF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.
(Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.
(Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable).
(Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.
The Ser/Thr-rich domain is heavily O-glycosylated.
Cell membrane>Single-pass type I membrane protein.
Cell membrane>Lipid-anchor.
Secreted.
Secreted.
Secreted.
Cell membrane>Lipid-anchor.
Cell membrane>Lipid-anchor.
Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3 (By similarity).
Belongs to the receptors of complement activation (RCA) family.
Research Fields
· Human Diseases > Cardiovascular diseases > Viral myocarditis.
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.