EEF1G Antibody - #DF4034
Product: | EEF1G Antibody |
Catalog: | DF4034 |
Description: | Rabbit polyclonal antibody to EEF1G |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 50kD; 50kD(Calculated). |
Uniprot: | P26641 |
RRID: | AB_2836327 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4034, RRID:AB_2836327.
Fold/Unfold
2610301D06Rik; AA407312; eEF 1B gamma; EEF 1G; eEF-1B gamma; EEF1G; EF 1 gamma; EF 1G; EF-1-gamma; EF1 gamma; EF1G; EF1G_HUMAN; Elongation factor 1 gamma; Elongation factor 1-gamma; Eukaryotic translation elongation factor 1 gamma; GIG 35; GIG35; MGC103354; MGC114210; MGC144723; MGC144724; MGC94929; Pancreatic tumor related protein; PRO1608; Translation elongation factor eEF 1 gamma chain;
Immunogens
A synthesized peptide derived from human EEF1G, corresponding to a region within the internal amino acids.
Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.
- P26641 EF1G_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Probably plays a role in anchoring the complex to other cellular components.
Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.