Product: AGBL4 Antibody
Catalog: DF3981
Description: Rabbit polyclonal antibody to AGBL4
Application: WB IF/ICC
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 62 KD; 58kD(Calculated).
Uniprot: Q5VU57
RRID: AB_2836341

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
AGBL4 Antibody detects endogenous levels of total AGBL4.
RRID:
AB_2836341
Cite Format: Affinity Biosciences Cat# DF3981, RRID:AB_2836341.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AGBL4; ATP/GTP binding protein like 4; ATP/GTP-binding protein-like 4; CBPC6_HUMAN; CCP6; Cytosolic carboxypeptidase 6; FLJ14442;

Immunogens

Immunogen:

A synthesized peptide derived from human AGBL4, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNSKGDKKSSVNHKDPSTPF

Research Backgrounds

Function:

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes polyglutamates from the carboxy-terminus of target proteins such as MYLK. Mediates deglutamylation of CGAS, regulating the antiviral activity of CGAS. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5.

Subcellular Location:

Cytoplasm>Cytosol. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome>Centriole. Golgi apparatus. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Colocalizes with gamma-tubulin in the centrioles at interphase and dividing cells and with glutamylated tubulin in basal bodies of ciliated cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase M14 family.

References

1). One potential biomarker for teratozoospermia identified by in-depth integrative analysis of multiple microarray data. Aging (Albany NY), 2021 (PubMed: 33819193) [IF=3.9]

Application: WB    Species: Human    Sample:

Figure 3 The flowchart of the whole analysis process and AGBL4 gene validation. (A) The flowchart of the whole analysis process. After collecting the datasets GSE6872 and GSE6967, we combined differentially expressed gene screening, GSEA analysis, and WGCNA analysis to narrow down the most relevant modules (separately colored with turquoise and yellow) between the two datasets. Subsequently, after two intersections, three DEGs were screened. Then, we substituted these three differentially expressed genes into the other dataset (GSE6968) for validation and found that only AGBL4 gene had an identical expression trend to the first two datasets (GSE6872 and GSE6967). (B) AGBL4 gene validation in another dataset GSE6968. TZ, teratozoospermia samples; control, healthy samples. (C) AGBL4 gene expression validation using western blotting. TZ, teratozoospermia samples; control, healthy samples. The fold change calculation was finished based on gray intensities of protein bands. (D) AGBL4 gene expression validation using qRT-PCR. TZ, teratozoospermia samples; control, healthy samples.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.