CCNB1IP1 Antibody - #DF4016
| Product: | CCNB1IP1 Antibody |
| Catalog: | DF4016 |
| Description: | Rabbit polyclonal antibody to CCNB1IP1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 32 KD; 32kD(Calculated). |
| Uniprot: | Q9NPC3 |
| RRID: | AB_2836376 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4016, RRID:AB_2836376.
Fold/Unfold
C14orf18; CCNB1IP1; Chromosome 14 open reading frame 18; CIP1_HUMAN; Cyclin B1 interacting protein 1; cyclin B1 interacting protein 1, E3 ubiquitin protein ligase; Cyclin-B1-interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; Enhancer of invasion 10; Gm288; HEI10; Human enhancer of invasion 10; mei4;
Immunogens
A synthesized peptide derived from human CCNB1IP1, corresponding to a region within the internal amino acids.
Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung.
- Q9NPC3 CIP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ubiquitin E3 ligase that acts as a limiting factor for crossing-over during meiosis: required during zygonema to limit the colocalization of RNF212 with MutS-gamma-associated recombination sites and thereby establish early differentiation of crossover and non-crossover sites. Later, it is directed by MutL-gamma to stably accumulate at designated crossover sites. Probably promotes the dissociation of RNF212 and MutS-gamma to allow the progression of recombination and the implementation of the final steps of crossing over (By similarity). Modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
Ubiquitinated; autoubiquitinated.
Phosphorylated by CDK1 on serine or threonine residues (in vitro).
Nucleus. Chromosome.
Note: Associates to the synaptonemal complex.
Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.