RNF144B Antibody - #DF4028
| Product: | RNF144B Antibody |
| Catalog: | DF4028 |
| Description: | Rabbit polyclonal antibody to RNF144B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 33 KD; 34kD(Calculated). |
| Uniprot: | Q7Z419 |
| RRID: | AB_2836388 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4028, RRID:AB_2836388.
Fold/Unfold
bA528A10.3; E3 ubiquitin protein ligase RNF144B; E3 ubiquitin-protein ligase RNF144B; IBR domain containing 2; IBR domain containing protein 2; IBR domain-containing protein 2; IBRDC 2; IBRDC2; KIAA0161; MGC71786; OTTHUMP00000016079; OTTHUMP00000016080; OTTHUMP00000039360; p53 inducible RING finger protein; p53-inducible RING finger protein; p53RFP; PIR2; R144B_HUMAN; Ring finger 144B; RING finger protein 144B; RNF 144B; RNF144B;
Immunogens
Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis.
- Q7Z419 R144B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q7Z419 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S38 | Phosphorylation | Uniprot | |
| T302 | Phosphorylation | Uniprot |
Research Backgrounds
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se.
Auto-ubiquitinated.
Mitochondrion membrane>Single-pass membrane protein. Cytoplasm.
Note: Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation.
Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis.
Interacts with UBE2L3, UBE2L6 and LCMT2, as well as with BAX.
The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme (By similarity). The transmembrane domain is essential for translocation to the mitochondria upon induction of apoptosis.
Members of the RBR family are atypical E3 ligases. They interact with the E2 conjugating enzyme UBE2L3 and function like HECT-type E3 enzymes: they bind E2s via the first RING domain, but require an obligate trans-thiolation step during the ubiquitin transfer, requiring a conserved cysteine residue in the second RING domain.
Belongs to the RBR family. RNF144 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.