INSL4 Antibody - #DF4030
Product: | INSL4 Antibody |
Catalog: | DF4030 |
Description: | Rabbit polyclonal antibody to INSL4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 19 KD; 15kD(Calculated). |
Uniprot: | Q14641 |
RRID: | AB_2836390 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4030, RRID:AB_2836390.
Fold/Unfold
early placenta insulin like peptide (EPIL); Early placenta insulin like peptide A chain; Early placenta insulin like peptide; Early placenta insulin like peptide B chain; Early placenta insulin-like peptide A chain; EPIL; INSL4; INSL4_HUMAN; insulin like 4; insulin like 4 (placenta); Insulin like peptide 4; Insulin-like peptide 4; OTTHUMP00000021025; Placentin;
Immunogens
A synthesized peptide derived from human INSL4, corresponding to a region within the internal amino acids.
Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells.
- Q14641 INSL4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT
Research Backgrounds
May play an important role in trophoblast development and in the regulation of bone formation.
Secreted.
Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells.
Belongs to the insulin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.