GJB7 Antibody - #DF4081
Product: | GJB7 Antibody |
Catalog: | DF4081 |
Description: | Rabbit polyclonal antibody to GJB7 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Horse |
Mol.Wt.: | 24 KD; 26kD(Calculated). |
Uniprot: | Q6PEY0 |
RRID: | AB_2836455 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4081, RRID:AB_2836455.
Fold/Unfold
Connexin-25; Cx25; CXB7_HUMAN; Gap junction beta-7 protein; GJB7;
Immunogens
A synthesized peptide derived from human GJB7, corresponding to a region within C-terminal amino acids.
- Q6PEY0 CXB7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Cell membrane>Multi-pass membrane protein. Cell junction>Gap junction.
Weakly expressed in placenta.
Belongs to the connexin family. Beta-type (group I) subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.