GDF15 Antibody - #DF4096

Product: | GDF15 Antibody |
Catalog: | DF4096 |
Description: | Rabbit polyclonal antibody to GDF15 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Sheep, Dog |
Mol.Wt.: | 37 KD; 34kD(Calculated). |
Uniprot: | Q99988 |
RRID: | AB_2836470 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4096, RRID:AB_2836470.
Fold/Unfold
GDF 15; GDF-15; Gdf15; GDF15_HUMAN; Growth differentiation factor 15; Growth/differentiation factor 15; Macrophage inhibitory cytokine 1; MIC 1; Mic-1; MIC1; NAG 1; NAG-1; NAG1; NRG 1; NRG-1; NRG1; NSAID (nonsteroidal anti inflammatory drug) activated protein 1; NSAID; NSAID regulated protein 1; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; PDF; PLAB; Placental bone morphogenetic protein; Placental bone morphogenic protein; Placental TGF beta; Placental TGF-beta; Prostate differentiation factor; PTGF beta; PTGFB;
Immunogens
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney (PubMed:9348093). Detected in plasma (at protein level) (PubMed:28572090, PubMed:29046435).
- Q99988 GDF15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99988 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S44 | O-Glycosylation | Uniprot | |
S146 | Phosphorylation | Uniprot | |
K265 | Ubiquitination | Uniprot | |
K303 | Ubiquitination | Uniprot |
Research Backgrounds
Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which contitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling (By similarity).
Secreted.
Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney. Detected in plasma (at protein level).
Homodimer; disulfide-linked. Interacts with GFRAL; ligand of GFRAL which mediates GDF15 internalization and cellular signaling through interaction with RET.
Belongs to the TGF-beta family.
References
Application: WB Species: mice Sample: tumor tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.