RAD Antibody - #DF4104
| Product: | RAD Antibody |
| Catalog: | DF4104 |
| Description: | Rabbit polyclonal antibody to RAD |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 33 KD; 33kD(Calculated). |
| Uniprot: | P55042 |
| RRID: | AB_2836478 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4104, RRID:AB_2836478.
Fold/Unfold
GTP binding protein RAD; GTP-binding protein RAD; RAD; RAD_HUMAN; RAD1; RAS (RAD and GEM) like GTP binding 3; Ras associated with diabetes; Ras related associated with diabetes; REM3; RRAD;
Immunogens
Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
- P55042 RAD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P55042 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R14 | Methylation | Uniprot | |
| S26 | Phosphorylation | Uniprot | |
| T27 | Phosphorylation | Uniprot | |
| S39 | Phosphorylation | Uniprot | |
| T52 | Phosphorylation | Uniprot | |
| S79 | Phosphorylation | Uniprot | |
| K204 | Ubiquitination | Uniprot | |
| S214 | Phosphorylation | P17252 (PRKCA) , P05771 (PRKCB) , P68400 (CSNK2A1) | Uniprot |
| S257 | Phosphorylation | P17252 (PRKCA) , P17612 (PRKACA) , P68400 (CSNK2A1) , P05771 (PRKCB) | Uniprot |
| S273 | Phosphorylation | Q9UQM7 (CAMK2A) , P68400 (CSNK2A1) , P17612 (PRKACA) , P17252 (PRKCA) , Q13555 (CAMK2G) | Uniprot |
| S290 | Phosphorylation | P17252 (PRKCA) , P05771 (PRKCB) , P68400 (CSNK2A1) | Uniprot |
| S299 | Phosphorylation | P17252 (PRKCA) , P05771 (PRKCB) , P68400 (CSNK2A1) | Uniprot |
| S301 | Phosphorylation | Uniprot |
Research Backgrounds
May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.
Cell membrane.
Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
Interacts with calmodulin preferentially in the inactive, GDP-bound form. Binds CAMKII which is capable of phosphorylating RAD in vitro. Interacts with CAMK2D and CACNB2. Interaction with CACNB2 regulates the trafficking of CACNA1C to the cell membrane (By similarity).
Belongs to the small GTPase superfamily. RGK family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.