EMX1 Antibody - #DF4121
| Product: | EMX1 Antibody |
| Catalog: | DF4121 |
| Description: | Rabbit polyclonal antibody to EMX1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 28 KD; 28kD(Calculated). |
| Uniprot: | Q04741 |
| RRID: | AB_2836486 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4121, RRID:AB_2836486.
Fold/Unfold
Empty spiracles homeobox 1; Empty spiracles homolog 1; empty spiracles homolog 1 Drosophila; Empty spiracles like protein 1; Empty spiracles-like protein 1; EMX1; EMX1_HUMAN; Homeobox protein EMX1;
Immunogens
A synthesized peptide derived from human EMX1, corresponding to a region within the internal amino acids.
- Q04741 EMX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
Nucleus. Cytoplasm.
Note: Might be shuttling between the nucleus and the cytoplasm.
Cerebral cortex.
Belongs to the EMX homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.