Product: MBL2 Antibody
Catalog: DF4152
Description: Rabbit polyclonal antibody to MBL2
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Chicken
Mol.Wt.: 27 KD(Observed); 26kD(Calculated).
Uniprot: P11226
RRID: AB_2836517

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(82%), Bovine(%), Sheep(%), Rabbit(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
MBL2 Antibody detects endogenous levels of total MBL2.
RRID:
AB_2836517
Cite Format: Affinity Biosciences Cat# DF4152, RRID:AB_2836517.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

COLEC 1; COLEC1; Collectin-1; HSMBPC; Lectin, mannose-binding, soluble, 2; Mannan binding lectin; Mannan binding protein; Mannan-binding protein; Mannose binding lectin (protein C) 2 soluble; Mannose binding lectin (protein C) 2, soluble (opsonic defect); Mannose binding lectin (protein C) 2, soluble; Mannose binding lectin 2 soluble; Mannose binding lectin 2, soluble (opsonic defect); Mannose binding lectin; Mannose binding lectin protein C2 soluble opsonic defect; Mannose binding protein; Mannose binding protein C; Mannose binding protein C precursor; Mannose binding protein, serum; Mannose-binding lectin; Mannose-binding protein C; MBL 2; MBL; MBL2; MBL2_HUMAN; MBL2D; MBP 1; MBP; MBP C; MBP-C; MBP1; MBPB; MBPC; MBPD; MGC116832; MGC116833; Opsonic defect; protein C; Soluble mannose binding lectin;

Immunogens

Immunogen:

A synthesized peptide derived from human MBL2, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P11226 MBL2_HUMAN:

Plasma protein produced mainly in the liver.

Sequence:
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
91
Sheep
91
Rabbit
91
Pig
82
Chicken
82
Horse
64
Dog
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Plasma protein produced mainly in the liver.

Family&Domains:

The coiled-coil domain mediates trimerization.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.

· Organismal Systems > Immune system > Complement and coagulation cascades.   (View pathway)

References

1). Mannose-Binding Lectin 2 as a Potential Therapeutic Target for Hepatocellular Carcinoma: Multi-Omics Analysis and Experimental Validation. Cancers, 2023 (PubMed: 37835594) [IF=5.2]

Application: WB    Species: human    Sample: Huh7 and BEL-7404 cell

Figure 3. MBL2 inhibits HCC proliferation, migration, and invasion in vitro. (A) Fluorescence was used to show the transfection efficiency of lentiviruses carrying the MBL2 gene and the green fluorescent protein tag. (B,C) qPCR and Western blot assays were conducted to validate the successful establishment of MBL2 overexpression in Huh7 and BEL-7404 cell lines. (D,E) CCK-8 (D) and plate colony assays (E) were used to evaluate the effects of MBL2 on suppressing HCC proliferation. (F,G) Transwell (F) and wound healing assays (G) were used to assess the inhibitory effects of MBL2 on HCC migration and invasion (** p < 0.01, *** p < 0.001, **** p < 0.0001). MBL2, mannose-binding lectin 2; HCC, hepatocellular carcinoma; CCK-8, cell counting kit-8.

Application: IF/ICC    Species: human    Sample: Huh7 and BEL-7404 cell

Figure 3. MBL2 inhibits HCC proliferation, migration, and invasion in vitro. (A) Fluorescence was used to show the transfection efficiency of lentiviruses carrying the MBL2 gene and the green fluorescent protein tag. (B,C) qPCR and Western blot assays were conducted to validate the successful establishment of MBL2 overexpression in Huh7 and BEL-7404 cell lines. (D,E) CCK-8 (D) and plate colony assays (E) were used to evaluate the effects of MBL2 on suppressing HCC proliferation. (F,G) Transwell (F) and wound healing assays (G) were used to assess the inhibitory effects of MBL2 on HCC migration and invasion (** p < 0.01, *** p < 0.001, **** p < 0.0001). MBL2, mannose-binding lectin 2; HCC, hepatocellular carcinoma; CCK-8, cell counting kit-8.

Application: IHC    Species: human    Sample: Huh7 and BEL-7404 cell

Figure 3. MBL2 inhibits HCC proliferation, migration, and invasion in vitro. (A) Fluorescence was used to show the transfection efficiency of lentiviruses carrying the MBL2 gene and the green fluorescent protein tag. (B,C) qPCR and Western blot assays were conducted to validate the successful establishment of MBL2 overexpression in Huh7 and BEL-7404 cell lines. (D,E) CCK-8 (D) and plate colony assays (E) were used to evaluate the effects of MBL2 on suppressing HCC proliferation. (F,G) Transwell (F) and wound healing assays (G) were used to assess the inhibitory effects of MBL2 on HCC migration and invasion (** p < 0.01, *** p < 0.001, **** p < 0.0001). MBL2, mannose-binding lectin 2; HCC, hepatocellular carcinoma; CCK-8, cell counting kit-8.

2). Salidroside inhibits osteoclast differentiation based on osteoblast-osteoclast interaction via HIF-1a pathway. Chinese journal of natural medicines, 2025 (PubMed: 40383613) [IF=4.0]

3). The autocrine action of salidroside on osteoclast during osteoclastogenesis via hypoxia-inducible factor-1 α pathway. Human & experimental toxicology, 2024 (PubMed: 39197164) [IF=2.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.