SLC25A11 Antibody - #DF4173
| Product: | SLC25A11 Antibody |
| Catalog: | DF4173 |
| Description: | Rabbit polyclonal antibody to SLC25A11 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 35 KD; 34kD(Calculated). |
| Uniprot: | Q02978 |
| RRID: | AB_2836538 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4173, RRID:AB_2836538.
Fold/Unfold
M2OM_HUMAN; Mitochondrial 2 oxoglutarate/malate carrier protein; Mitochondrial 2-oxoglutarate/malate carrier protein; OGC; OGCP; SLC20A4; SLC25A11; Solute carrier family 20 (oxoglutarate carrier) member 4; Solute carrier family 20 member 4; Solute carrier family 25 (mitochondrial carrier oxoglutarate carrier) member 11; Solute carrier family 25 member 11;
Immunogens
A synthesized peptide derived from human SLC25A11, corresponding to a region within the internal amino acids.
- Q02978 M2OM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. Maintains mitochondrial fusion and fission events, and the organization and morphology of cristae. Involved in the regulation of apoptosis (By similarity). Acts as a tumor-suppressor gene implicated in the predisposition to metastatic paraganglioma.
Mitochondrion inner membrane>Multi-pass membrane protein.
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.