NCR3 Antibody - #DF4221
Product: | NCR3 Antibody |
Catalog: | DF4221 |
Description: | Rabbit polyclonal antibody to NCR3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 30 KD; 22kD(Calculated). |
Uniprot: | O14931 |
RRID: | AB_2836572 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4221, RRID:AB_2836572.
Fold/Unfold
1C7; Activating natural killer receptor p30; Activating NK A1 receptor; CD337; CD337 antigen; LY117; Lymphocyte antigen 117; MALS; Natural cytotoxicity triggering receptor 3; Natural killer cell p30 related protein; Natural killer cell p30-related protein; Ncr3; NCTR3_HUMAN; NK-p30; NKp30;
Immunogens
A synthesized peptide derived from human NCR3, corresponding to a region within the internal amino acids.
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
- O14931 NCTR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Research Backgrounds
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
Cell membrane>Single-pass type I membrane protein.
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
Belongs to the natural cytotoxicity receptor (NCR) family.
Research Fields
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.