NMU Antibody - #DF4238

Product: | NMU Antibody |
Catalog: | DF4238 |
Description: | Rabbit polyclonal antibody to NMU |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Zebrafish, Bovine, Xenopus |
Mol.Wt.: | 22 KD; 20kD(Calculated). |
Uniprot: | P48645 |
RRID: | AB_2836589 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4238, RRID:AB_2836589.
Fold/Unfold
Neuromedin U 25; Neuromedin U; Neuromedin-U-25; NmU 25; NMU; NmU-25; NMU_HUMAN;
Immunogens
Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
- P48645 NMU_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P48645 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S109 | O-Glycosylation | Uniprot |
Research Backgrounds
Ligand for receptors NMUR1 and NMUR2 (By similarity). Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder.
Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release although its potency is much lower than that of neuromedin precursor-related peptide 36.
Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release from lactotroph cells in the pituitary gland, probably via the hypothalamic dopaminergic system.
Secreted.
Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
Belongs to the NmU family.
References
Application: WB Species: Human Sample: colon cancer cells
Application: WB Species: Human Sample: LUAD cells and lung normal cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.