NUTF2 Antibody - #DF4260
| Product: | NUTF2 Antibody |
| Catalog: | DF4260 |
| Description: | Rabbit polyclonal antibody to NUTF2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 14 KD; 14kD(Calculated). |
| Uniprot: | P61970 |
| RRID: | AB_2836611 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4260, RRID:AB_2836611.
Fold/Unfold
NTF 2; NTF-2; NTF2; NTF2_HUMAN; Nuclear transport factor 2; Nutf2; Placental protein 15; PP15;
Immunogens
A synthesized peptide derived from human NUTF2, corresponding to a region within the internal amino acids.
- P61970 NTF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Cytoplasm>Cytosol. Nucleus outer membrane. Nucleus>Nuclear pore complex. Nucleus inner membrane. Nucleus>Nucleoplasm.
Note: At steady state it is essentially nucleoplasmic, enriched in nucleoplasmic foci.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.