ZDHHC7 Antibody - #DF4276
| Product: | ZDHHC7 Antibody |
| Catalog: | DF4276 |
| Description: | Rabbit polyclonal antibody to ZDHHC7 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep |
| Mol.Wt.: | 35 KD; 35kD(Calculated). |
| Uniprot: | Q9NXF8 |
| RRID: | AB_2836627 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4276, RRID:AB_2836627.
Fold/Unfold
DHHC 7; DHHC7; FLJ10792; FLJ20279; Palmitoyltransferase ZDHHC7; ZDHHC 7; Zinc finger DHHC domain containing 7; Zinc finger DHHC domain containing protein 7; Zinc finger DHHC type containing 7; Zinc finger protein 370; ZNF 370; ZNF370;
Immunogens
A synthesized peptide derived from human ZDHHC7, corresponding to a region within C-terminal amino acids.
- Q9NXF8 ZDHC7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Palmitoyltransferase with broad specificity. Palmitoylates JAM3. Palmitoylates SNAP25 and DLG4/PSD95 (By similarity). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane and their function in rapid intracellular signaling upon binding of sex hormones. May play a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells (By similarity).
Autopalmitoylated.
Golgi apparatus membrane>Multi-pass membrane protein.
The DHHC domain is required for palmitoyltransferase activity.
Belongs to the DHHC palmitoyltransferase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.