RABL2A Antibody - #DF4374
| Product: | RABL2A Antibody |
| Catalog: | DF4374 |
| Description: | Rabbit polyclonal antibody to RABL2A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 30-34 KD; 26kD(Calculated). |
| Uniprot: | Q9UBK7 |
| RRID: | AB_2836662 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4374, RRID:AB_2836662.
Fold/Unfold
FLJ78724; MGC117180; OTTHUMP00000045491; OTTHUMP00000045492; OTTHUMP00000045493; OTTHUMP00000203788; OTTHUMP00000203792; Rab-like protein 2A; RABL2A; RBL2A_HUMAN; RP11-395L14.2;
Immunogens
A synthesized peptide derived from human RABL2A, corresponding to a region within C-terminal amino acids.
- Q9UBK7 RBL2A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS
Research Backgrounds
Plays an essential role in male fertility, sperm intra-flagellar transport, and tail assembly. Binds, in a GTP-regulated manner, to a specific set of effector proteins including key proteins involved in cilia development and function and delivers them into the growing sperm tail.
Expressed in the testis.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.