KCNK17 Antibody - #DF4308
| Product: | KCNK17 Antibody |
| Catalog: | DF4308 |
| Description: | Rabbit polyclonal antibody to KCNK17 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 40 KD; 37kD(Calculated). |
| Uniprot: | Q96T54 |
| RRID: | AB_2836676 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4308, RRID:AB_2836676.
Fold/Unfold
2P domain potassium channel Talk 2; 2P domain potassium channel Talk-2; acid sensitive potassium channel protein TASK 4; Acid-sensitive potassium channel protein TASK-4; K2p17.1; KCNK17; KCNKH_HUMAN; Potassium channel subfamily K member 17; Potassium channel, subfamily K, member 17; TALK 2; TALK-2; TALK2; TASK 4; TASK4; TWIK related acid sensitive K(+) channel 4; TWIK related alkaline pH activated K(+) channel 2; TWIK-related acid-sensitive K(+) channel 4; TWIK-related alkaline pH-activated K(+) channel 2;
Immunogens
A synthesized peptide derived from human KCNK17, corresponding to a region within C-terminal amino acids.
- Q96T54 KCNKH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Research Backgrounds
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.
Membrane>Multi-pass membrane protein.
Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.