KCNG3 Antibody - #DF4318
Product: | KCNG3 Antibody |
Catalog: | DF4318 |
Description: | Rabbit polyclonal antibody to KCNG3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 50 KD; 50kD(Calculated). |
Uniprot: | Q8TAE7 |
RRID: | AB_2836686 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4318, RRID:AB_2836686.
Fold/Unfold
KCNG 3; Kcng3; KCNG3_HUMAN; KV10.1; Kv10.1a; Kv10.1b; KV6.3; OTTHUMP00000201478; OTTHUMP00000201479; Potassium voltage gated channel subfamily G member 3; Potassium voltage-gated channel subfamily G member 3; Voltage gated potassium channel 6.3; Voltage gated potassium channel Kv10.1; Voltage gated potassium channel subunit Kv10.1; Voltage gated potassium channel subunit Kv6.3; Voltage gated potassium channel subunit Kv6.4; Voltage-gated potassium channel subunit Kv10.1; Voltage-gated potassium channel subunit Kv6.3;
Immunogens
Expressed in the brain, liver, testis, small intestine, colon, thymus and adrenal gland (PubMed:11852086, PubMed:12060745).
- Q8TAE7 KCNG3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSIPAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELKFRSARYSRSLSTEFLN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8TAE7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S10 | Phosphorylation | Uniprot | |
K28 | Ubiquitination | Uniprot |
Research Backgrounds
Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1; this promotes a reduction in the rate of activation and inactivation of the delayed rectifier voltage-gated potassium channel KCNB1.
Cell membrane>Multi-pass membrane protein. Cytoplasm.
Note: Has to be associated with KCNB1 or possibly another partner to get inserted in the plasma membrane (PubMed:12060745). Colocalizes with KCNB1 at the plasma membrane (PubMed:12060745, PubMed:19074135). Remains intracellular in the absence of KCNB1 (PubMed:12060745).
Expressed in the brain, liver, testis, small intestine, colon, thymus and adrenal gland.
Heterotetramer with KCNB1. Does not form homomultimers.
The transmembrane segment S4 functions as voltage-sensor and is characterized by a series of positively charged amino acids at every third position. Channel opening and closing is effected by a conformation change that affects the position and orientation of the voltage-sensor paddle formed by S3 and S4 within the membrane. A transmembrane electric field that is positive inside would push the positively charged S4 segment outwards, thereby opening the pore, while a field that is negative inside would pull the S4 segment inwards and close the pore. Changes in the position and orientation of S4 are then transmitted to the activation gate formed by the inner helix bundle via the S4-S5 linker region.
Belongs to the potassium channel family. G (TC 1.A.1.2) subfamily. Kv6.3/KCNG3 sub-subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.