| Product: | PPP1R14D Antibody |
| Catalog: | DF4343 |
| Description: | Rabbit polyclonal antibody to PPP1R14D |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 24 KD(Observed); 17kD(Calculated). |
| Uniprot: | Q9NXH3 |
| RRID: | AB_2836711 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4343, RRID:AB_2836711.
Fold/Unfold
CPI17-like; Gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI; GBPI-1; GBPI1; Gut and brain phosphatase inhibitor 1; PKC dependent PP1 inhibitory protein; PP14D_HUMAN; Ppp1r14d; Protein phosphatase 1 regulatory subunit 14D; Protein phosphatase 1, regulatory (inhibitor) subunit 14D;
Immunogens
A synthesized peptide derived from human PPP1R14D, corresponding to a region within the internal amino acids.
- Q9NXH3 PP14D_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibitor of PPP1CA. Has inhibitory activity only when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
Phosphorylated on several residues.
Cytoplasm.
Detected in colon, intestine, kidney and brain cortex.
Belongs to the PP1 inhibitor family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.