PPM1L Antibody - #DF4349
| Product: | PPM1L Antibody |
| Catalog: | DF4349 |
| Description: | Rabbit polyclonal antibody to PPM1L |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 48 KD; 41kD(Calculated). |
| Uniprot: | Q5SGD2 |
| RRID: | AB_2836717 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4349, RRID:AB_2836717.
Fold/Unfold
EC 3.1.3.16; in phosphatase 1 (formerly 2C) like; MGC132545; MGC132547; OTTHUMP00000213920; OTTHUMP00000213921; PP2C epsilon; PP2C-epsilon; PP2CE; PPM1 like; PPM1-LIKE; PPM1L; PPM1L_HUMAN; Protein phosphatase 1 (formerly 2C)-like; Protein phosphatase 1 like; Protein phosphatase 1-like; Protein phosphatase 1L; Protein phosphatase 2C epsilon isoform; Protein phosphatase 2C isoform epsilon; Protein phosphatase, Mg2+/Mn2+ dependent, 1L;
Immunogens
A synthesized peptide derived from human PPM1L, corresponding to a region within the internal amino acids.
Ubiquitous. Highly expressed in heart, placenta, lung, liver, kidney and pancreas.
- Q5SGD2 PPM1L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.
Membrane>Single-pass type I membrane protein.
Ubiquitous. Highly expressed in heart, placenta, lung, liver, kidney and pancreas.
Belongs to the PP2C family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.