S100A16 Antibody - #DF4353

Product: | S100A16 Antibody |
Catalog: | DF4353 |
Description: | Rabbit polyclonal antibody to S100A16 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 20 KD; 12kD(Calculated). |
Uniprot: | Q96FQ6 |
RRID: | AB_2836721 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4353, RRID:AB_2836721.
Fold/Unfold
2300002L21Rik; AAG13; Aging associated gene 13 protein; Aging associated protein 13; Aging-associated gene 13 protein; AI325039; AI663996; DT1P1A7; MGC17528; Protein S100 A16; Protein S100-A16; Protein S100-F; Protein S100F; S100 calcium binding protein A16; S100 calcium-binding protein A16; S100A16; S100F; S10AG_HUMAN;
Immunogens
Ubiquitous (PubMed:14684152). Highly expressed in esophagus, adipose tissues and colon. Expressed at lower level in lung, brain, pancreas and skeletal muscle. Expression is up-regulated in tumors of bladder, lung, thyroid gland, pancreas and ovary (PubMed:14684152). Expressed in astrocytes (PubMed:17030513).
- Q96FQ6 S10AG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96FQ6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
Y20 | Phosphorylation | Uniprot | |
K25 | Ubiquitination | Uniprot | |
Y26 | Phosphorylation | Uniprot | |
S27 | Phosphorylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
K35 | Ubiquitination | Uniprot | |
S51 | Phosphorylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K61 | Acetylation | Uniprot | |
K61 | Ubiquitination | Uniprot | |
S101 | Phosphorylation | Uniprot | |
S102 | Phosphorylation | Uniprot | |
S103 | Phosphorylation | Uniprot |
Research Backgrounds
Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity).
Nucleus>Nucleolus. Cytoplasm.
Note: Primarily nucleolar. A high intracellular calcium level induces nucleolar exit and nucleocytoplasmic transport, whereas a low intracellular calcium level leads to nuclear translocation and accumulation within specific region of nucleoli (PubMed:17030513).
Ubiquitous. Highly expressed in esophagus, adipose tissues and colon. Expressed at lower level in lung, brain, pancreas and skeletal muscle. Expression is up-regulated in tumors of bladder, lung, thyroid gland, pancreas and ovary. Expressed in astrocytes.
Homodimer. Interacts with TP53 (By similarity).
S100A16 proteins, but not other S100 proteins, have only one functional Ca(2+) binding site per monomer. Upon Ca(2+) binding, undergoes conformational changes leading to the exposure of hydrophobic patches which could be implicated in the Ca(2+) -dependent nuclear export. Binds Zn(2+). Ca(2+) and Zn(2+) do not bind to the same site. Does not bind Cu(2+).
Belongs to the S-100 family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.