S100A3 Antibody - #DF4354
| Product: | S100A3 Antibody |
| Catalog: | DF4354 |
| Description: | Rabbit polyclonal antibody to S100A3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Rabbit, Dog |
| Mol.Wt.: | 0 KD; 12kD(Calculated). |
| Uniprot: | P33764 |
| RRID: | AB_2836722 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4354, RRID:AB_2836722.
Fold/Unfold
Protein S 100E; Protein S-100E; Protein S100 A3; Protein S100-A3; S100 calcium binding protein A3; S100 calcium-binding protein A3; S100a3; S100E; S10A3_HUMAN;
Immunogens
A synthesized peptide derived from human S100A3, corresponding to a region within the internal amino acids.
- P33764 S10A3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
More than half of the arginine residues undergo citrullination by PAD1 and PAD2. Arg-51 is specifically citrullinated by PAD3 and promotes tetramerization.
Cytoplasm.
Skin specific, specifically expressed at the inner endocuticle of hair fibers.
Belongs to the S-100 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.