RASL10A Antibody - #DF4390
Product: | RASL10A Antibody |
Catalog: | DF4390 |
Description: | Rabbit polyclonal antibody to RASL10A |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 30 KD; 23kD(Calculated). |
Uniprot: | Q92737 |
RRID: | AB_2836745 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4390, RRID:AB_2836745.
Fold/Unfold
Ras like protein family member 10A; Ras like protein RRP22; RAS like, family 10, member A; RAS related on chromosome 22; Ras related protein on chromosome 22; Ras related protein on chromosome 22 homolog; Ras-like protein family member 10A; Ras-like protein RRP22; Ras-related protein on chromosome 22; RASL 10A; Rasl10a; RASL10A protein; Rasl10a RAS like, family 10, member A; RRP 22; RRP22; RSLAA_HUMAN;
Immunogens
A synthesized peptide derived from human RASL10A, corresponding to a region within the internal amino acids.
- Q92737 RSLAA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Potent inhibitor of cellular proliferation.
Isoprenylation is essential for nucleolar localization, and the proliferation-inhibiting activity of RASL10A.
Cell membrane>Lipid-anchor>Cytoplasmic side. Nucleus>Nucleolus.
Note: May cycle in and out of the nucleolus in a GTP-dependent manner.
Expression appears to be strictly limited to the central nervous system.
Belongs to the small GTPase superfamily. Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.