RASL10B Antibody - #DF4391
Product: | RASL10B Antibody |
Catalog: | DF4391 |
Description: | Rabbit polyclonal antibody to RASL10B |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 22 KD; 23kD(Calculated). |
Uniprot: | Q96S79 |
RRID: | AB_2836746 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4391, RRID:AB_2836746.
Fold/Unfold
MGC47540; Ras like protein family member 10B; Ras like protein VTS58635; Ras-related protein 17; RRP17;
Immunogens
A synthesized peptide derived from human RASL10B, corresponding to a region within the internal amino acids.
Expressed at high levels in skeletal muscle and, at much lower levels, in heart, brain and pancreas.
- Q96S79 RSLAB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May facilitate the release of atrial natriuretic peptide by cardiomyocytes and hence play a role in the regulation of arterial pressure.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Expressed at high levels in skeletal muscle and, at much lower levels, in heart, brain and pancreas.
Belongs to the small GTPase superfamily. Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.