RAB40B Antibody - #DF4405
| Product: | RAB40B Antibody |
| Catalog: | DF4405 |
| Description: | Rabbit polyclonal antibody to RAB40B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 34 KD; 31kD(Calculated). |
| Uniprot: | Q12829 |
| RRID: | AB_2836760 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4405, RRID:AB_2836760.
Fold/Unfold
FLJ42385; GTP binding protein homologous to Saccharomyces cerevisiae SEC4; RAB40B member RAS oncogene family; RAR; Rar protein; Ras related protein Rab 40B; RP23 293H17.2; SEC4L; SOCS box containing protein RAR;
Immunogens
A synthesized peptide derived from human RAB40B, corresponding to a region within C-terminal amino acids.
- Q12829 RB40B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
Research Backgrounds
May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Cell membrane>Lipid-anchor>Cytoplasmic side.
The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.