RAP2B Antibody - #DF4410
| Product: | RAP2B Antibody |
| Catalog: | DF4410 |
| Description: | Rabbit polyclonal antibody to RAP2B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 18 KD; 21kD(Calculated). |
| Uniprot: | P61225 |
| RRID: | AB_2836765 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4410, RRID:AB_2836765.
Fold/Unfold
MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; Ras related protein RAP2B; Ras-related protein Rap-2b; Small GTP binding protein;
Immunogens
A synthesized peptide derived from human RAP2B, corresponding to a region within the internal amino acids.
- P61225 RAP2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Palmitoylated. Unlike RAP2A and RAP2C, palmitoylation of RAP2B is not required for association with recycling endosome membranes and activation of TNIK.
Recycling endosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Associated with red blood cells-released vesicles.
Expressed in red blood cells (at protein level).
The effector domain mediates the interaction with RUNDC3A.
Belongs to the small GTPase superfamily. Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.