RHOB Antibody - #DF4438
Product: | RHOB Antibody |
Catalog: | DF4438 |
Description: | Rabbit polyclonal antibody to RHOB |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 22 KD; 22kD(Calculated). |
Uniprot: | P62745 |
RRID: | AB_2836793 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4438, RRID:AB_2836793.
Fold/Unfold
Aplysia RAS-related homolog 6; ARH6; ARHB; H6; MST081; MSTP081; oncogene RHO H6; ras homolog family member B; ras homolog gene family, member B; Rho cDNA clone 6; Rho related GTP binding protein RhoB Precursor; Rho-related GTP-binding protein RhoB; Rhob; RHOB_HUMAN; RHOH6;
Immunogens
- P62745 RHOB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62745 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Ubiquitination | Uniprot | |
T19 | Phosphorylation | Uniprot | |
S26 | Phosphorylation | Uniprot | |
Y34 | Phosphorylation | Uniprot | |
T60 | Phosphorylation | Uniprot | |
Y66 | Phosphorylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
T129 | Phosphorylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
S185 | Phosphorylation | P48729 (CSNK1A1) | Uniprot |
Research Backgrounds
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Prenylation specifies the subcellular location of RHOB. The farnesylated form is localized to the plasma membrane while the geranylgeranylated form is localized to the endosome.
(Microbial infection) Glycosylated at Tyr-34 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rho and leads to actin disassembly.
Late endosome membrane>Lipid-anchor. Cell membrane>Lipid-anchor. Nucleus. Cleavage furrow.
Note: Late endosomal membrane (geranylgeranylated form). Plasma membrane (farnesylated form). Also detected at the nuclear margin and in the nucleus. Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.
Binds ROCK1 and ROCK2 (By similarity). Also binds PKN1/PRK1. Interacts with ARGGEF3. Interacts with RTKN (By similarity). Interacts with AKAP13. Interacts with RIPOR1.
Belongs to the small GTPase superfamily. Rho family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.