SCAMP1 Antibody - #DF4453
| Product: | SCAMP1 Antibody |
| Catalog: | DF4453 |
| Description: | Rabbit polyclonal antibody to SCAMP1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Dog, Chicken, Xenopus |
| Mol.Wt.: | 32 KD; 38kD(Calculated). |
| Uniprot: | O15126 |
| RRID: | AB_2836808 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4453, RRID:AB_2836808.
Fold/Unfold
SCAM1_HUMAN; SCAMP 1; SCAMP 37; SCAMP; SCAMP1; SCAMP37; Secretory carrier associated membrane protein 1; Secretory carrier membrane protein 1; Secretory carrier membrane protein; Secretory carrier-associated membrane protein 1;
Immunogens
A synthesized peptide derived from human SCAMP1, corresponding to a region within N-terminal amino acids.
- O15126 SCAM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Golgi apparatus>trans-Golgi network membrane>Multi-pass membrane protein. Recycling endosome membrane>Multi-pass membrane protein.
Widely expressed, with highest expression in brain.
Belongs to the SCAMP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.