Product: NEK7 Antibody
Catalog: DF4467
Description: Rabbit polyclonal antibody to NEK7
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 35 KD; 35kD(Calculated).
Uniprot: Q8TDX7
RRID: AB_2836822

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
NEK7 Antibody detects endogenous levels of total NEK7.
RRID:
AB_2836822
Cite Format: Affinity Biosciences Cat# DF4467, RRID:AB_2836822.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EC 2.7.11.1; NEK7; NEK7_HUMAN; Never in mitosis A-related kinase 7; Never in mitosis gene a-related kinase 7; NIMA (never in mitosis gene a) related kinase 7; NIMA (never in mitosis gene a)-related expressed kinase 7; NimA related protein kinase 7; NIMA-related kinase 7; NimA-related protein kinase 7; Serine/threonine-protein kinase Nek7;

Immunogens

Immunogen:

A synthesized peptide derived from human NEK7, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q8TDX7 NEK7_HUMAN:

Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine.

Sequence:
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
78
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Protein kinase which plays an important role in mitotic cell cycle progression. Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Phosphorylates RPS6KB1.

PTMs:

Phosphorylation at Ser-195 required for its activation.

Subcellular Location:

Nucleus. Cytoplasm. Cytoplasm>Cytoskeleton>Spindle pole. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Present at centrosome throughout the cell cycle (PubMed:17586473). Also detected at spindle midzone of the anaphase cells and eventually concentrates at the midbody (PubMed:17586473). Interaction with ANKS3 prevents its translocation to the nucleus (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in lung, muscle, testis, brain, heart, liver, leukocyte and spleen. Lower expression in ovary, prostate and kidney. No expression seen in small intestine.

Family&Domains:

Displays an autoinhibited conformation: Tyr-97 side chain points into the active site, interacts with the activation loop, and blocks the alphaC helix. The autoinhibitory conformation is released upon binding with NEK9.

The NTE (N-terminal extension) motif is a structural component of the catalytic domain and thus contributes to activity.

Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.

Research Fields

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

References

1). Butylchlorogenate from Chaenomeles speciosa alleviates ulcerative colitis via suppressing NLRP3 inflammasome activation and remodeling intestinal homeostasis. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 41005055) [IF=6.7]

2). Erianin isolated from Dendrobium huoshanense alleviated neuroinflammation in MPTP-induced Parkinson's disease model via NF-κB/NLRP3 pathway. Journal of ethnopharmacology, 2025 (PubMed: 40074095) [IF=4.8]

3). Total tanshinones protect against acute lung injury through the PLCγ2/NLRP3 inflammasome signaling pathway. JOURNAL OF ETHNOPHARMACOLOGY, 2023 (PubMed: 37121449) [IF=4.8]

4). CDK9-mediated transcriptional activation of NEK7 promotes NLRP3-dependent podocyte Pyroptosis in diabetic kidney disease. International immunopharmacology, 2026 (PubMed: 41512791) [IF=4.8]

5). Quercetin-induced pyroptosis in colon cancer through NEK7-mediated NLRP3 inflammasome-GSDMD signaling pathway activation. American journal of cancer research, 2024 (PubMed: 38590424) [IF=3.6]

Application: WB    Species: Human    Sample: colon cancer tissues

Figure 7 Downregulated expression of NEK7 in human colon cancer tissues and correlated with NLRP3 expression. A. Gene correlation between NLRP3 and NEK7 in colon cancer investigated using the TIMER2.0 database based on Spearman’s correlation analysis. Rho represents the correlation index. B. Influence of NEK7 knockdown on NLRP3 protein expression determined using western blotting (n=3, where “n” represents the number of independent repeated experiments). Values are presented as mean ± SD. *P

6). Attenuation of ROS/Chloride Efflux-Mediated NLRP3 Inflammasome Activation Contributes to Alleviation of Diabetic Cardiomyopathy in Rats after Sleeve Gastrectomy. Oxidative Medicine and Cellular Longevity, 2022 (PubMed: 35498125)

Application: WB    Species: Rat    Sample: diabetic myocardium

"Figure 4 SG attenuates the activation of NLRP3 in diabetic myocardium. (a) Protein levels of NLRP3-related molecules shown by western blot. β-Tubulin was an internal reference control. n = 3 in each group. (b) Relative mRNA levels of Nlrp3-relaterd genes shown by real-time RT-PCR. Tubb3 served as a reference gene. n = 3 in each group. (c) Ratio of caspase-1 p12/procaspase-1. n = 3 in each group. (d) Caspase-1 activity in heart tissues. n = 6 in each group. Immunohistochemical staining of (e) NLRP3, (f) ASC, (g) GSDMD, (h) IL-1β, (i) IL-18, and (j) NEK7. Scale bar, 50 μm. (k) Double-labeling immunofluorescence of NLRP3 and CD68. Scale bar, 50 μm. Data are presented as mean ± SD. ∗∗P < 0.01 CON vs. SHAM; ##P < 0.01 SG vs. SHAM. n = 3 in each group."

Application: IHC    Species: Rat    Sample: diabetic myocardium

"Figure 4 SG attenuates the activation of NLRP3 in diabetic myocardium. (a) Protein levels of NLRP3-related molecules shown by western blot. β-Tubulin was an internal reference control. n = 3 in each group. (b) Relative mRNA levels of Nlrp3-relaterd genes shown by real-time RT-PCR. Tubb3 served as a reference gene. n = 3 in each group. (c) Ratio of caspase-1 p12/procaspase-1. n = 3 in each group. (d) Caspase-1 activity in heart tissues. n = 6 in each group. Immunohistochemical staining of (e) NLRP3, (f) ASC, (g) GSDMD, (h) IL-1β, (i) IL-18, and (j) NEK7. Scale bar, 50 μm. (k) Double-labeling immunofluorescence of NLRP3 and CD68. Scale bar, 50 μm. Data are presented as mean ± SD. ∗∗P < 0.01 CON vs. SHAM; ##P < 0.01 SG vs. SHAM. n = 3 in each group."

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.