SHB Antibody - #DF4495
| Product: | SHB Antibody |
| Catalog: | DF4495 |
| Description: | Rabbit polyclonal antibody to SHB |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 55 KD; 55kD(Calculated). |
| Uniprot: | Q15464 |
| RRID: | AB_2836846 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4495, RRID:AB_2836846.
Fold/Unfold
bA3J10.2; OTTHUMP00000021397; RP11 3J10.8; RP113J10.8; SH2 domain containing adapter protein B; SH2 domain-containing adapter protein B; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); SHB adaptor protein; Shb; SHB_HUMAN; Src homology 2 domain containing adaptor protein B; Src homology 2 protein;
Immunogens
- Q15464 SHB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15464 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Phosphorylation | Uniprot | ||
| S10 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| Y27 | Phosphorylation | Uniprot | |
| Y96 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| Y114 | Phosphorylation | Uniprot | |
| S129 | Phosphorylation | Uniprot | |
| S154 | Phosphorylation | Uniprot | |
| S158 | Phosphorylation | Uniprot | |
| S164 | Phosphorylation | Uniprot | |
| S165 | Phosphorylation | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| T172 | Phosphorylation | Uniprot | |
| S190 | Phosphorylation | Uniprot | |
| S211 | Phosphorylation | Uniprot | |
| T213 | Phosphorylation | Uniprot | |
| K218 | Acetylation | Uniprot | |
| T241 | Phosphorylation | Uniprot | |
| Y246 | Phosphorylation | Uniprot | |
| S247 | Phosphorylation | Uniprot | |
| S265 | Phosphorylation | Uniprot | |
| Y268 | Phosphorylation | Uniprot | |
| Y272 | Phosphorylation | Uniprot | |
| Y297 | Phosphorylation | Uniprot | |
| T299 | Phosphorylation | Uniprot | |
| Y301 | Phosphorylation | Uniprot | |
| S307 | Phosphorylation | Uniprot | |
| S310 | Phosphorylation | Uniprot | |
| S312 | Phosphorylation | Uniprot | |
| S314 | Phosphorylation | Uniprot | |
| S317 | Phosphorylation | Uniprot | |
| S323 | Phosphorylation | Uniprot | |
| Y336 | Phosphorylation | Uniprot | |
| S363 | Phosphorylation | Uniprot | |
| S367 | Phosphorylation | Uniprot | |
| S388 | Phosphorylation | Uniprot | |
| S437 | Phosphorylation | Uniprot | |
| Y484 | Phosphorylation | Uniprot | |
| Y485 | Phosphorylation | Uniprot | |
| Y502 | Phosphorylation | Uniprot | |
| T508 | Phosphorylation | Uniprot |
PTMs - Q15464 As Enzyme
Research Backgrounds
Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Phosphorylated upon PDGFRA, PDGFRB, TCR, IL2 receptor, FGFR1 or VEGFR2 activation.
Cytoplasm. Cell membrane>Peripheral membrane protein>Cytoplasmic side.
Note: Associates with membrane lipid rafts upon TCR stimulation.
Widely expressed.
Interacts with PTPN11 (By similarity). Interacts with phosphorylated 'Tyr-720' of the ligand-activated receptor PDGFRA via its SH2 domain. Interacts with the ligand-activated receptors PDGFRB, FGFR1, KDR/VEGFR2, IL2RB and IL2RG. Interacts with EPS8 and V-SRC. Interacts with GRB2 and GRAP. Interacts with CD3Z. Interacts with tyrosine-phosphorylated LAT upon T-cell antigen receptor activation. Interacts with PLCG1. Interacts with ZAP70, LCP2/SLP-76, VAV1 and GRAP2. Interacts with JAK1 and JAK3. Interacts with PTK2/FAK1. Interacts with CRK/CrKII. Interacts with IRS2.
The SH2 domain preferentially binds phosphopeptides with the consensus sequence Y-[TVI]-X-L and mediates interaction with PDGFRA, PDGFRB, FGRFR1, IL2RB, IL2RG, CD3Z and CRK/CrKII.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.